SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z5K7L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z5K7L1
Domain Number 1 Region: 33-134
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.11e-28
Family Chaperone J-domain 0.00021
Further Details:      
 
Domain Number 2 Region: 209-322
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000105
Family Thioltransferase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Z5K7L1
Sequence length 465
Comment (tr|A0A1Z5K7L1|A0A1Z5K7L1_FISSO) DnaJ homolog subfamily B member 6 {ECO:0000313|EMBL:GAX22219.1} KW=Complete proteome; Reference proteome OX=1519565 OS=Fistulifera solaris (Oleaginous diatom). GN=FisN_19Lh284 OC=Bacillariophycidae; Naviculales; Naviculaceae; Fistulifera.
Sequence
MKLQQQSLRLFWLLLFLTFLSSHGKAARHANFSAKDDYYDILGVSKKANAKDIKAAYRKL
ALKYHPDKVPDDEKEKAEEIFVKVSEAYSILSDDDKRKVYDQYGKQGLEMMERGIDPNAG
GFGSAGGGFGAGGGQTYNFKFNAGSAGGHTFQFDPFSMFQEMFGAGGMGGFESGNFKVHF
DGFDGAQFGGGGARPGKPKAAAPKVDLFKDVPNVTRLGKPKYPNEKSKYLWLVVFYDYQH
PRSEKAKGPIETLASKISGSYKIGAMNCGRNKDEANFCLELGIDLEDLPQFAFVVAGQHT
FYDDSSKLPNARQLHEFVTQNMPTDNIRNINSVEHLQERLIEPLLHPSNEKHDAAILLLS
DKYETGAMFASVAYQHRDKFLFGESRAKNLVLAKEFDLKRYPLLLAFVPAGHGDEEYNDE
VDLVRFHNHPDLETINKWIDRLHTTQSTLGRRRRQRRKKAGHDEF
Download sequence
Identical sequences A0A1Z5K7L1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]