SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z5RE08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z5RE08
Domain Number 1 Region: 101-180
Classification Level Classification E-value
Superfamily PA domain 0.000000157
Family PA domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Z5RE08
Sequence length 534
Comment (tr|A0A1Z5RE08|A0A1Z5RE08_SORBI) Uncharacterized protein {ECO:0000313|EMBL:OQU81829.1} KW=Complete proteome; Reference proteome OX=4558 OS=Sorghum bicolor (Sorghum) (Sorghum vulgare). GN=SORBI_3006G127600 OC=Sorghum.
Sequence
MATDHRVSLLPFAAALLVLLLAGGAAADDASSSDDAGTSRTPGCSNKFQLVKVKNWVNGT
EGTTVVGLSAKFGAPLPRDIHEAKKSFAVLANPIDCCSNLTSKLTSSVALATRGECAFTE
KANTAQAGGATGLLVINDNEELYKMVCGENDTSINVTIPVVMIPQSAGKMLKNFLHHGAS
VEVQLYSPNRPTVDLSACFLWIMAVGTIVCASLWTEFVTCEQVDERYNQLTRKDGPDTGT
NYREDKEIFEISAKGAIVFIIVASVFLLLLFYFMSSWFVWVLIVLFCIGGIEGMHVCLVT
LLARIFNDCGRKTVQLPFLGEILILSVGIVPFCVVFAILWAVYRHASFAWIGQDVLGICL
MITVLQMARLPNIKVASALLSAAFVYDVFWVFISPLIFNESVMIAVARGDNTGESIPMLL
RIPRFFDPWGGYDMIGFGDIIFPGLLVAFSYRFDRATRKGVLNGYFLWLIVGYAVGLFIT
YLALFLMDGQGQPALLYLVPCTLGVIVILGWLRGELHELWNYGKSRAENLVNEP
Download sequence
Identical sequences A0A1Z5RE08
4558.Sb06g020770.1 XP_002446699.1.57931 jgi|Sorbi1|5057414|Sb06g020770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]