SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z9S671 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z9S671
Domain Number 1 Region: 21-141
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0000235
Family Clostridium neurotoxins, "coiled-coil" domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z9S671
Sequence length 152
Comment (tr|A0A1Z9S671|A0A1Z9S671_9PROT) F-type ATPase subunit b {ECO:0000256|HAMAP-Rule:MF_01398} KW=Complete proteome; Reference proteome OX=1986821 OS=Pelagibacteraceae bacterium TMED259. GN=CBE19_01975 OC=Pelagibacteraceae.
Sequence
MPQLEQIEFFISQLFWLGVFFGILIVVLTYFTLPKIRAFLNKRDEFVNSHLSKQDELIKK
AEQLVQDYETKINEAKDQASQIINEAKESALQESEKLIKETEDKIQSEIKKTEERVNQEK
KQALNDLEDQLKDSATSFLGKITNLNKEDIKI
Download sequence
Identical sequences A0A1Z9S671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]