SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A209B4W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A209B4W9
Domain Number 1 Region: 4-246
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.11e-30
Family Proline iminopeptidase-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A209B4W9
Sequence length 258
Comment (tr|A0A209B4W9|A0A209B4W9_9ACTN) Alpha/beta hydrolase {ECO:0000313|EMBL:OWA00018.1} KW=Complete proteome OX=1982762 OS=Streptomyces sp. CS159. GN=B9W64_36635 OC=Streptomyces.
Sequence
MRKVVSRDGTTIAYEKTGDGPPIVLLNGSFRDHTIFDALVPELAPHCTTYVYDRRGRGQS
GDSPEYAVGREIEDLEAVIQEAGGSAVVFAGSSGANLAVEAALAGAPISKLALHEPFYRV
DGFPKPPWNVAKTLRVLMEEDRREEAVEYYLGSFLGLTPDTVAQWRQGPIWAVNEANAHT
LAYDLAICGDCTVPAERLAGYTTQTLVLNSSGTSEWLRAAARATAAALPEGRSLELPGSW
HRIDMDVLGRTLAEFATA
Download sequence
Identical sequences A0A209B4W9 H1Q5R8
WP_007387476.1.4903 WP_007387476.1.9901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]