SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A209C7U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A209C7U9
Domain Number 1 Region: 214-341
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000157
Family SMI1/KNR4-like 0.0072
Further Details:      
 
Domain Number 2 Region: 27-122
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000785
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A209C7U9
Sequence length 374
Comment (tr|A0A209C7U9|A0A209C7U9_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:OWA13292.1} KW=Complete proteome OX=1982761 OS=Streptomyces sp. CS113. GN=B9W62_00795 OC=Streptomyces.
Sequence
MNASDPHVDAFAEIFGDPPADFAVPVDWAAVESWLGTGLPADYKAVAAAYGPLDIGARLW
LHVPCVNRGWFDYGAWVQQARRAAPGVLPFGATRTADTLYWDTTASDDPDQWPVVMHCQD
DENAGRDPWRRFTTPLVPTLARLVADGMRPVAVRSGMQSEPEDTPWTPPPRRPEPTARQR
AALTAGSGLDTLLTLVPPPEAPLLGKHHWDWLYERLGTHLPGEYVRLMERYGAGSWCGWL
RFSVPFDEDRYALAPWAEWYGKTYQEQRAQFPQYHPLAVHPEPGGFLPFADSIDGDQLCW
LTEGATPDDWPLIVLPRHADQGPPLGTGLTGTLLEWLRGRFATEGLPPLGRRDEDPLEYI
AFEPYDVEPAGDDQ
Download sequence
Identical sequences A0A209C7U9
WP_087804163.1.11632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]