SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A210PGN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210PGN8
Domain Number 1 Region: 373-485
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-24
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 2 Region: 162-270
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-20
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 3 Region: 276-314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 4 Region: 575-609
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 327-377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000072
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 6 Region: 530-578
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000694
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A210PGN8
Sequence length 939
Comment (tr|A0A210PGN8|A0A210PGN8_MIZYE) Low-density lipoprotein receptor-related protein 12 {ECO:0000313|EMBL:OWF35627.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT13857 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MELQLLRTASAFSYHHTLHTLPVSNNSGFRSPVLILDTPELGRLNTEVHHGGHSNPVSLT
RKESRSHAVVRWILRLTVQKLPKWKHQRSCDCQTGQPRSVVEICRQVDKIEHLLSTVINN
NKITSFNSHSSDHDDVALSIAVSVLYLLISCAGAQSTDSCKSEEYNKNHGTITSPDYPAH
YPTNFCKDWFITGNTNDIITISFKMFDVETGILGNCGRDYLEIGPHPKVKLCGNTSSITS
RVYISTAKHVRIHFSSDYMTTGAGFELMYIMGPLQTKRCEQDQFRCHSGKCIFNEWRCNG
LAECEDHSDEANCPHETHSTTPPTTHICTNSTLLCEDIGTGRNRCIPKAQWCDGEKDCLH
GEDEDSKLCPSFKCNSHIDSQTGFVVSPNFPHDYPNNLSCTWTIHVQDTKAQVQLRFIKF
ELQKEAGTDFLTVYDGTYHEGKVIGVYFGGLADVPTMVESTTDYVTLKFTTNRVRAESGF
NITFQKKGVCLPDQSSCGTAEKDCFPTDKACDGVWNCRLHGGDEKGCGGCDKEHFRCGLK
GSHQCYEEKQRCNGISRCAELDDELNCNSVLCGSHNGTFLCDNKRCIYETWKCDKTNDCG
DNSDETDCPRSTNLITIAAVAGSLICALLLVVAMGCTCKLYNLRMQQFHGPRHETPLTRM
YAEFMRRRAPPPYHEAMLTSRPYDEVRQELAEQNNQNETAGSRTRRHRRRTARLPHRQQI
ASNSTAGQSSQQNDSCSTDTTSNQQTEGNQGPGESSQTINSSNLTWNTDSHSSTLALIPD
NSSDTTEGPDESGDESDQPDGEHVSFSRDIGITARWQRPRNSGKESSSSECQNLLQADPP
DSPLSAGRGSGDVTTTSCDSVDPSSIITENTNTRDSDNESDKSCDTDLLGASSSLLRQDE
SLISFTDRGLGEAQHETSDSSSDTDAITMGESSSHSELF
Download sequence
Identical sequences A0A210PGN8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]