SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A210QXS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A210QXS5
Domain Number 1 Region: 606-863
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-47
Family Ankyrin repeat 0.00052
Further Details:      
 
Domain Number 2 Region: 93-142,194-399
Classification Level Classification E-value
Superfamily PP2C-like 3.66e-44
Family PP2C-like 0.0018
Further Details:      
 
Domain Number 3 Region: 900-941
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000114
Family SOCS box-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A210QXS5
Sequence length 994
Comment (tr|A0A210QXS5|A0A210QXS5_MIZYE) [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial {ECO:0000313|EMBL:OWF53512.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT13625 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence
MSLRFFKLLQMSPTCSSAPLVTFSKFMMPSCGRVGLTLLRSFHSSVSYLVPNTSPKLSPQ
QVNSYIRLNEQSIHGEGAVKSFDCNRLPANNPIEDRDASAKLKNSKTGQYLFGVFDGHGG
DFCSQAVCERLYNYISVTMSPPETLDMIRKANYEISSLVHWLHGPQSVFTDVMENVYKAK
LAKLASEILSLSEETTIKENLISAFNSLDHDLMIEAAPTTLNRELQFNSMQMAFQGSCAC
VAMLDDTELFIANTGDCRAVLGVQDEHGWNALPLSQMHDAANPSEIRRLLQVHPNERSNM
IQQGRLFGILAPLRAFGDAQFKWSARDLKHVEKTSAYDIPIYGKTLMPRGYQTPPYVTAE
PEIIQHSLTPKDKFLIIASDGLWEQMPAEKVVQLVGGHNIGHQIPVNFQPTSNMNLRDIN
EMLKKRQNDLKKKPQDDNVCSYLLRHALGPEHQRISETLSLAPARKFVTGVVLVKGRCSE
RGITRPCEGKSAGKSKTLTCGKVSRQKDVYSYSSSSRRQVKSSRNRTVKKRSDCPTEENG
AMPDICLSPSNAQLQKMMKKRLSLAPVAKEFVDFIHAGDHKNVKRMIKERVVDVNLRDTE
DPVLPTPLLIAAEMNDEEMVRLMLRAKPKPANINDETTKGKRAIWIAAKHGNVEMVEYLL
NGKSPCEVNIVDKESGCSPLFRAILTESAEACQLLIKAGADVNLRRLSLENSNETPLIKA
IQMDNRDICQILVNSLCKLQTKTDAGLNALHFAVAYCRYDIVELLMENGVKIHAKSNAGI
TAMSVAIENHNAAMVKILLKKGYKVDKKYKWKETPLQQAIKLHATESALTLMHHGCTVKK
DKGSSYMHMAVEEKLIRIIKFLIALNPLFLNEEWLQKQMWPVSLYRRPDIFNWLQKEAAT
PRTLKQLCRARIFKLLGTYAPAKAKELPLPETLREYLQYNEFVKDEYYKQKPLNSKECPF
DCPAKCSYRHCPPIEVSASESESESDSDVEIDSS
Download sequence
Identical sequences A0A210QXS5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]