SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212ENW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212ENW5
Domain Number 1 Region: 85-223
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.4e-38
Family CRAL/TRIO domain 0.0013
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000249
Family CRAL/TRIO N-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A212ENW5
Sequence length 224
Comment (tr|A0A212ENW5|A0A212ENW5_DANPL) Putative SEC14 cytosolic factor {ECO:0000313|EMBL:OWR43173.1} KW=Complete proteome; Reference proteome OX=278856 OS=Danaus plexippus plexippus. GN=KGM_207468 OC=Danaus.
Sequence
MAEELKPVKDEDLKQLKERMQLIAEADPSQFHNDYSLKRYLRAFKTVDNAFQAILKSNKW
RVEYGVANLHENHELIEKYSNRARVLRHRDMIGRPIVYIPAKNHSSSDRSIDELTKFIVY
CLEDASKKCFEEVIDNLCIVFDLNNFTLSCMDYQVLKNLIWLLSRHYPERLGVCLIINAP
TFFSGCWAVIKGWLDENTAGKVTFVNSEMDLCQYLIPDILPTDM
Download sequence
Identical sequences A0A212ENW5
DPGLEAN09489-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]