SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212F142 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212F142
Domain Number 1 Region: 108-254
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.41e-32
Family CRAL/TRIO domain 0.00064
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000017
Family CRAL/TRIO N-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A212F142
Sequence length 278
Comment (tr|A0A212F142|A0A212F142_DANPL) Uncharacterized protein {ECO:0000313|EMBL:OWR47462.1} KW=Complete proteome; Reference proteome OX=278856 OS=Danaus plexippus plexippus. GN=KGM_215282 OC=Danaus.
Sequence
MSEISEKQANSVVQLKEWVKGQPHLPQNLDEHLLLRFAHSCYYDMDKAKTTVETFFTVRN
SCSDLLTNRDPNSHHMQKIMKVINIGQYELSDNTCLWLWQINDPGLDTYDYTLDAKLFFL
TTDAFFMSDKHLYESDIVLMDVKDISLKFITKLNISVARKLAKYQEDAIPIRLKQVHVIN
APSFIDKIYGVLKPFMRKEHTEMIHFHSPKSETLFKYIKKEDLPEDYGGLKPSLAELTEN
SLEKVMNNREQLLDENLWRTKKNGTSVDEGSFRKLAID
Download sequence
Identical sequences A0A212F142
DPGLEAN16627-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]