SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212FFN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212FFN5
Domain Number 1 Region: 486-577
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.89e-17
Family Eukaryotic proteases 0.01
Further Details:      
 
Domain Number 2 Region: 19-58
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 78-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 259-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000945
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 198-240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 6 Region: 114-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 7 Region: 163-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000113
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A212FFN5
Sequence length 598
Comment (tr|A0A212FFN5|A0A212FFN5_DANPL) Pattern recognition serine proteinase {ECO:0000313|EMBL:OWR52542.1} KW=Complete proteome; Reference proteome OX=278856 OS=Danaus plexippus plexippus. GN=KGM_215001A OC=Danaus.
Sequence
MFVTLLFLSVFPKIFTAVVPQAVCSPDEFTCSDDVCISQGLVCDGHSDCWNAADEMACNG
LSDPLSDLMIRRPKRQTQNCRKNQWQCRDGTCIGFDGKCDGVVDCPDFSDETFALCRDMQ
CQSNWFRCTYGACVDGSAPCNGVQECADNSDELLPRCRNQTIGSRGKHTCDNGQVISSVD
ICDGKKDCADGSDETLATCAGNSCPSYVFQCAYGACVDQNAKCNKVEECADGSDETDELC
NRLAPGQPVTPATRPPPQGGNCLLPPYPQYGSYKVRQYPNAVPGQRYPNVRLDVTCNPGF
QTENNNSIFCDNGEWSGPMPACLRFCRLNKHPSVEYRCLLSGNSVTGSRECGSLEPSGTV
VTPICRSPNYYSSGVMSNMHCVEGSWDYIAVCKPGLTNVTISIDSLEIIITSDNAHVIIN
NYGNKEVKVVNNISNADRIVFEDSRTTTSRPTASRTTTSGPTSANYDNEIDEGDWRMASV
DTIGFQAQPVRPKKCGTITPEGIQLVIGGRSAKRGELPWHAGIYSKLFTPYMQICGGSLI
STTTIISAAHCFWSDTKKLLPASEYAVAVGKLYRPYNEKHDADAEKSDVRRKYITSNT
Download sequence
Identical sequences A0A212FFN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]