SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A218UL85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A218UL85
Domain Number 1 Region: 436-654
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000134
Family MIF4G domain-like 0.069
Further Details:      
 
Domain Number 2 Region: 4-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000538
Family APC10-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A218UL85
Sequence length 940
Comment (tr|A0A218UL85|A0A218UL85_9PASE) Centrosomal protein {ECO:0000313|EMBL:OWK54368.1} KW=Complete proteome; Reference proteome OX=299123 OS=Lonchura striata domestica (Bengalese finch). GN=RLOC_00004187 OC=Estrildidae; Estrildinae; Lonchura.
Sequence
MPHKIGFTVVSSSGHEDGFSARELMVHAPTVNGWRSPRLCQYPQEITLQLVERCRVRKLQ
LLAHQYMIASKIEFYISESLPEYFAPYQSERFQRLGYVPLSDNEKTDFRARELKSVYMDA
VGQYLKLIFHRNYVNKYNLYGQVSLVAVNIIGDPADYDIDTMSSPSREKLIDHYLGIKLD
DPALDGTYLGKCDSISPLDDLAFDMYQDPEVAQIIRRLDEKKREAVHLECYDHAKKLKQA
IADLQKVGERLGRYEVEKRYAVEKEDYDLAKKKKEQMDEYRLKVYQQLELHDLLDAQLLI
RKPPELALESVSGTESPQSSHPEPADPLQGEPLRAEPVLEEQLVDPTSSESVVPYQSPLS
PQIQPTTSKEAFPKENVEILPYDERPLPAVCKKVDEVVAYVESEVTEEDVGDAPRTGNTG
EPEQLTEKALKEASPVVEVFGETLVSGAYSRTWSHREDALLTVYKKLMEVSVDTPKEDLR
NMLRAAVFLVRKAIKDTVSSVFQASLKLLKMIIVQYIPKHKLGKQETSHCLETTLPHLLS
RTGDSSSRLRLLASTFIQEMALCPEVKPLQIIPVHLIKTLKPNATTHLVMSHVELVESLL
RAMGTENSGFTINNVMKFAMGALEHRAHEVREVVLRIIFAMYREHRAAVLEFLPLDDAGA
RRTVRYKTLFEGFAKIDGKSETEVRAQKKAATETEKQTKEGKKVLKGHPAALKLELKAEV
EAEKEKESDFEKTQNQGYKVYETAAAKIQKELSSVANYLDNLCIFCGERNEAFTEEGLDL
HYWKHCPVLTRCEHCKQMLEISSLTEHLLSDCDKRDSFGRCPRCREAVPKDELPRHIKSR
LCNPAKPENVANHCPLCHENFPPGEEAWRFHLMNGDGCKMNQRRMFPLNKTILLQPAKVA
GHYLRRPGPSGVRVQPPPEGSKIRTRGSPNKSTGKTYSKR
Download sequence
Identical sequences A0A218UL85
XP_021389941.1.53032 XP_021389942.1.53032 XP_021389943.1.53032 XP_021389944.1.53032 XP_021389945.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]