SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A218UR28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A218UR28
Domain Number 1 Region: 23-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000067
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A218UR28
Sequence length 118
Comment (tr|A0A218UR28|A0A218UR28_9PASE) Proepiregulin {ECO:0000313|EMBL:OWK55890.1} KW=Complete proteome; Reference proteome OX=299123 OS=Lonchura striata domestica (Bengalese finch). GN=RLOC_00014283 OC=Estrildidae; Estrildinae; Lonchura.
Sequence
MENCTTALIQTENSPRVAQVGITRCKPEMKDYCFHGQCVYIVDLDEHYCRCDVGFSGVRC
VHSELVRQPLSKEYVALTVIVVLLFLAALSLASYYICRRYRNKRRQTNASEYKEVGAL
Download sequence
Identical sequences A0A218UR28 H0YTI3
ENSTGUP00000001596 59729.ENSTGUP00000001596 XP_012428707.1.42559 XP_012428708.1.42559 ENSTGUP00000001596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]