SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A218VEL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A218VEL8
Domain Number 1 Region: 1048-1361
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.12e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000031
Further Details:      
 
Domain Number 2 Region: 1325-1564
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.5e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000865
Further Details:      
 
Domain Number 3 Region: 316-510
Classification Level Classification E-value
Superfamily Fibronectin type III 5.63e-48
Family Fibronectin type III 0.0004
Further Details:      
 
Domain Number 4 Region: 508-713
Classification Level Classification E-value
Superfamily Fibronectin type III 3.81e-36
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 30-124
Classification Level Classification E-value
Superfamily Immunoglobulin 6.86e-19
Family I set domains 0.0035
Further Details:      
 
Domain Number 6 Region: 133-225
Classification Level Classification E-value
Superfamily Immunoglobulin 2.57e-17
Family I set domains 0.028
Further Details:      
 
Domain Number 7 Region: 228-322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000114
Family I set domains 0.011
Further Details:      
 
Domain Number 8 Region: 719-846
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000235
Family Fibronectin type III 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A218VEL8
Sequence length 1572
Comment (tr|A0A218VEL8|A0A218VEL8_9PASE) Receptor-type tyrosine-protein phosphatase F {ECO:0000313|EMBL:OWK64359.1} KW=Complete proteome; Reference proteome OX=299123 OS=Lonchura striata domestica (Bengalese finch). GN=RLOC_00002269 OC=Estrildidae; Estrildinae; Lonchura.
Sequence
MVPNFCIQVLTVPAAILCCLMLPLAGADSKPTFMKAPEDQIGISGGVASFVCQATGEPKP
RITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRVHRDEAIYECTATNSVGEINTSAKL
TVLEEDHLPAGFPTIDMGPQLKVVEKARTATMLCAASGNPDPEISWFKDFLPVDTATSNG
RIKQLRSGALQIENSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSNHE
VMPGGSVNLTCVAVGAPMPYVKWMAGVEELTKEDEMPVGRNVLELNNIMQSANYTCVAIS
SLGMIEATAQITVKALPKPPTEPLVTETTATSVTLTWDSGNSDPISYYVIQYKPKSLEGQ
FQEVDGVATTRYSIGGLSPFSEYEFRVIAVNNIGRGPPSELVEARTGEQAPSSPPLKVQA
RMLSASTMLVQWEQPEEPNGQIRGYRVYYTTDPHLPLSMWQKHNTDDSHLTTVGSLITGT
TYSIRVLAFTSVGDGPPSDIIQVKTQQGVPAQPADFQAEAESDTRILLTWLPASQERITK
YELLYWEGEDGTQQKVEFDPTSSYAVEGLKPDTLYKFRLGARSELGVGVYTPTVEARTAQ
SMPSAPPRKVEVESVNSTAIRVSWKLPISNKQHGQIRGYQVTYVKLENNEPRGQPVIKDV
MLSEAQWRAEDSVDHETVIGGLLPETTYSVTVAAYTTKGDGARSKPKVITTTGAVFAKNF
RVNAVMKTSVLLSWEVPDSYKSAVPFKILYNSQSVEVDGHSMKKLISDLQPDTDYSFVLM
NRGSSAGGLQHLVSIRTAPDVLQSKPIATNKYIQEGKFTLTLPKVQTTVPVRWYYIVVVP
ADQSTSTLTARWRTPDEMELDQLLEAISQGSQSRRQRRQADRLKPYIAAQVDVLPETFTL
GDEKNYKGFYNKPLSQDLSYRCFVLASLEDGDTKRYAASPYSDEIVMEVASAKQQDEPEM
LWVMGPVLAVILIIIIVIAILLFKSKQERKRAHSPSSKDEHSIGLKDSLLAHSSDPVEMR
RLNYQTPGASVPCCPNISSMRDHPPIPVTDLADNIDRLKANDGLKFSQEYESIDPGQQFT
WENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGP
LPETLSDFWRMVWEQRTATIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVVLLDTVELA
TYTVRTFALYKNGSNEKTELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPTDAGPMVV
HCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLE
AATCGNTEVPARNLFAHIQKLTQVPPGESVTEMELEFKMLANSKAHTSRFISANLPCNKF
KNRLVNIMPYELTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRM
LWEHDSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTD
ARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITDQYQLCYRAA
LEYLGSFDHYAT
Download sequence
Identical sequences A0A218VEL8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]