SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A218X9R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A218X9R2
Domain Number 1 Region: 28-129
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.3e-29
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 218-333
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000292
Family Thioltransferase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A218X9R2
Sequence length 600
Comment (tr|A0A218X9R2|A0A218X9R2_PUNGR) Uncharacterized protein {ECO:0000313|EMBL:OWM81697.1} KW=Complete proteome; Reference proteome OX=22663 OS=Punica granatum (Pomegranate). GN=CDL15_Pgr007735 OC=Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica.
Sequence
MKHPARVKIRLMISLLVVCSICLVAVEAKRIDPYKVLGIDKNASQRDIQKAFHKLSLQYH
PDKNKNKGAQEKFAEINNAYEILSDEEKRKNYDLYGDEKGDPGFDPGQTGAGGGGGGGGG
GGGGYTYFTSGGPGSTFGPGGWQTMGGPGGGFKTFSYSFGGSDPFASFDIGDMFNGFFQG
GQSGGFKSSGQSGGFKSSGQSGGFKSSAGSQFGSRSPTQSSIRTVNSQVFKNEIAERGMT
WLLLFKTPGLKDNEYYESQIEEVGNSLQGVLKVGVVNCDNEPSLCKDLGTHPRRFPRLFV
YTCNVVGNSGSLVEYHGDLVTKDLKVFCQEHLPQYSKRVDLKGVEFHPDSGNGLPSVLLL
STKKDTPAIWRALSGLYHKRFNFYDAQASRDVRDSSEPVVKKLGINSLPAIVGWLKNGDK
HVLGAGISVKDMKSAVSDLGSLLDAFERKNKKVASSHAKRSESDSASKQIPILTGSNLDA
LCGENVPVCIIGAFRSMKERRKLESILSTVSQKPLSRQQSSGNSISYTLLDASKYPEFLK
AFDNSGFKSSDKMLVAYKPRKGKFAVPANKITEEEVERFIGSVVNGDVQFSKTRRKPKLT
Download sequence
Identical sequences A0A218X9R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]