SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A223ZG87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A223ZG87
Domain Number 1 Region: 2-251
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.61e-127
Family Methyl-coenzyme M reductase gamma chain 0.000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A223ZG87
Sequence length 265
Comment (tr|A0A223ZG87|A0A223ZG87_9EURY) Methyl-coenzyme M reductase subunit gamma {ECO:0000256|PIRNR:PIRNR000264} KW=Complete proteome OX=2017966 OS=Methanothermobacter sp. EMTCatA1. GN=tca_01086 OC=Methanobacteriaceae; Methanothermobacter.
Sequence
MSYKAQYTPGETQIAENRRKHMDPDYEFRKLREVSDEDLVKVLGHRNPGESYKSVHPPLD
EMDFEEDIVRDMVEPIQGAKEGVRVRYIQFADSMYNAPAQPYDRARTYMWRYRGVDTGTL
SGRQVIEMRELDLEGVSKELVETELFDPATTGIRGATVHGHSLRLDENGLMFDALQRYVF
DEEKGHVVYVKDQVGRPLDEPVDMGQPLGEDELKKITTIYRKDNIAMRDDKEAIEVVENI
HTGRTMGGFGMDVFKDDLRKRLGDD
Download sequence
Identical sequences A0A223ZG87 T2GI75
187420.MTH1130 gi|15679141|ref|NP_276258.1| WP_010876754.1.101079 WP_010876754.1.22989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]