SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225WWH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225WWH6
Domain Number 1 Region: 339-470
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.89e-25
Family Chaperone J-domain 0.00018
Further Details:      
 
Domain Number 2 Region: 17-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000961
Family Ubiquitin-related 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A225WWH6
Sequence length 474
Comment (tr|A0A225WWH6|A0A225WWH6_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OWZ22016.1} KW=Complete proteome; Reference proteome OX=4795 OS=Phytophthora megakarya. GN=PHMEG_0003332 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MEGGIWAFYYLQGEDGEDRAHPNAFRLTGVSPGADVTLADVLRSFPLRNPAAFHFRFRLN
SSKGNTFYWLDVTQASQKVPLAGGRVICKLLRLERPQKVGLVFRRRPVLKWASGSQPPKR
QGSSSALGDSSSSVQSAKAVQPLADGSNFHRSSSSPGFEQGRPAKYSDRPSTGNSTEARH
SNASSRASSTSGEKKSVSRTGSGSKQTQGNLEDFLSGGQQSPGGSTASAVSPPKKDVNLM
SDSSWHDAPATPAQPANATSDFLNSMDPLAARTAPAAQVSPSKAVQRDPPKFDDDNGQTV
GPVTMAEMEAHSKSTSDGSNVYNPNLVDKSTKSEDVRRAMEERERQVQRDVERAREDLRK
REEAVRNMSAMKDNANAVLGPRLKGWAEDNGRVKNIRTLLSTMHQVMWEDCKWTEVNMGK
LIQPNDVKKHYRKAMIVVHPDKAGGRNAEQLLIAERVFAALNTAWEDFQKTNPC
Download sequence
Identical sequences A0A225WWH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]