SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A225ZTV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A225ZTV9
Domain Number 1 Region: 36-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.09e-31
Family Thioltransferase 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A225ZTV9
Sequence length 152
Comment (tr|A0A225ZTV9|A0A225ZTV9_CRYNV) Glutaredoxin {ECO:0000256|PIRNR:PIRNR005894} KW=Complete proteome OX=1230068 OS=Cryptococcus neoformans var. grubii c45. GN=C356_01385 OC=Cryptococcus neoformans species complex.
Sequence
MVFARLGLRTLRSLPQSQVARSTTILAQRRFLSAEARKLIDGAVKSNPLVVFMKGTPDAP
QCGFSRAVCQILDVQGVPRENLKTYNCLEDQELREGIKEYSEWPTIPQVYIKGEFVGGCD
ILLSMHQSGELEDLLIKEGLAPPLPEGPESSA
Download sequence
Identical sequences A0A225ZTV9 J9VP75
CNAG_03985T0 XP_012047594.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]