SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226MDA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226MDA5
Domain Number 1 Region: 7-136
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.53e-29
Family Ankyrin repeat 0.00043
Further Details:      
 
Domain Number 2 Region: 253-298
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000785
Family SOCS box-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A226MDA5
Sequence length 342
Comment (tr|A0A226MDA5|A0A226MDA5_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB53158.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_003561 OC=Odontophoridae; Callipepla.
Sequence
MDFTEAYSDRCSAAGLAAREGDAEVLQKLIAQGHSLDVPDNRGWMPIHEAAAHSSSRCLR
LLLNAGADINCQAKDRATPLLIAAQEGHATCVELLLSKGADPNLYCNEDNWQLPIHAAAE
MGHKNFFSLVDILLNYKITLLGINLGYCLYHEKFALFRRFLKMGCPLPSHEELPEFLSHA
VKALDGYMEWLPYLLLSGFNPVNLLYRFWLHSVSEDVLNFILEFTNWKRLPPAVEQNLAD
YKEKFNWTPKSHFATIPSLSHLCRLEIRSILGSERLRCDEFIRALPLPVCLQDDLLFLHL
LPVSTALGAEENLRQREEGAPSATASSSDRTEKGDACNSPAR
Download sequence
Identical sequences A0A226MDA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]