SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226MFT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226MFT5
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-30
Family Ankyrin repeat 0.00039
Further Details:      
 
Domain Number 2 Region: 233-278
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000719
Family SOCS box-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A226MFT5
Sequence length 322
Comment (tr|A0A226MFT5|A0A226MFT5_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB54152.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_012598 OC=Odontophoridae; Callipepla.
Sequence
GFVEIMKILLEKRANIECKDDFGITPLFVAAQYGRLESLRTLISHGADINCQAKDRATPL
LIAAQEGHATCVELLLSKGADPNLYCNEDNWQLPIHAAAEMGHKNFFSLVDILLNYKITL
LGINLGYCLYHEKFALFRRFLKIGCPLPSHEELPEFLSHAVKALDGYMEWLPYLLLSGFN
PVNLLYRFWLHSVSEDVLNFILEFTNWKRLPPAVEQNLADYKEKFNWTPKSHFATIPSLS
HLCRLEIRSILGSERLRCDEFIRALPLPVCLQDDLLFLHLLPVSTALGAEENLRQREEGA
PSATASSSDRTEKGDACNSPAR
Download sequence
Identical sequences A0A226MFT5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]