SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A226NAJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226NAJ0
Domain Number 1 Region: 60-207
Classification Level Classification E-value
Superfamily EF-hand 5.98e-41
Family Calmodulin-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226NAJ0
Sequence length 209
Comment (tr|A0A226NAJ0|A0A226NAJ0_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB64636.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_008712 OC=Odontophoridae; Callipepla.
Sequence
IRHEEKTCYKAVQTSEEGPSEYQGPLMVLAQNCAVMHNLLGPACIFLRKGFAENRQPDRE
LRPEEIEELREAFKEFDKDKDGFINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHV
DFEDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMKKLLGQQVGH
RDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Download sequence
Identical sequences A0A226NAJ0 G1N918
ENSMGAP00000008865 ENSMGAP00000008865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]