SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226NHX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226NHX2
Domain Number 1 Region: 29-234
Classification Level Classification E-value
Superfamily L domain-like 5.44e-49
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 257-452
Classification Level Classification E-value
Superfamily L domain-like 2.86e-42
Family Ngr ectodomain-like 0.066
Further Details:      
 
Domain Number 3 Region: 540-842
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.75e-32
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226NHX2
Sequence length 953
Comment (tr|A0A226NHX2|A0A226NHX2_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB67283.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_015924 OC=Odontophoridae; Callipepla.
Sequence
MMESFIFWGVLLACSARVRAAEPGAASPCPAQCHCEQDGIALAVDCSELGLTEVPAAPSP
LTAYLDLSMNNISRLQPNAFHPLRFLEELRLSGNQISSIPGEAFSGLYSLKILMLQNNQL
SRIPAEALRDLPNLQSLRLDANLISVVPEKSFEGLPSLRHLWLDDNALTEIPVRALNRLP
ALQAMTLALNRIWHIPDYAFQNLSSLVVLHLHNNRIQRLGANGFDGLHNLETLSGSELHL
NLDLKLNLNLQTQRSGRLDLNYNELLEFPGAIRTLGRLQELHFYDNPIQFVGQSAFQYLP
KLHTLSLNGATDIREFPDLKGTTSLEVLTLTRAGIRLLPRAVCQQLPNLRVLELSHNKIE
DLPSFHRCQRLQELGLQHNRIQEIGADTFVQLTALRSIDLSWNDLHFIHPDAFVTLRSLT
KLDLSDNRLAALPLGGLGGLTHLKLQGNPALSEPFAKDSFPNMRVLEVPYAYQCCAYGSC
GGFFRASNQWEAEGASPEDEDPHRRALELFPGHTDNHYDLEADDLQMDLEDSKLHPTIQC
TPSPGPFKPCDHLFESWIIRLGVWGIVLVSVLCNGLVVLAVFASPSYLSPVKFVIGSIAG
ANTLSGVACSMLALVDALTYGRFAQFGARWERGAGCRVTGFLAVFSSQAAVFLLALAAVQ
CSVSVSCARGCRKAPALGRVKAAVLGCLLLSSAAAVLPLFSIGEYGASPLCLPYPIPGGN
PATLGFTVALAMTNVLCFLAATGTYIRLYCSLLKGECGAVWDCAMVRHVAWLIFTNCLLY
CPVAFLTFSSTLNLFLITPEVIKSVLLVVLPLPACLNPVLYLLFNPHCRDDLRLLRQKGR
DKGSCAQPCGLDDTEKSSYDSTQALVSFSDIDHIFETPDSLGAHPILDSYRFPSTTLVPC
QQRMGTGGRERGCSEHCPCLSDSDILTAAESRETTARTPRAAPCPPPPYTSHI
Download sequence
Identical sequences A0A226NHX2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]