SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226PEF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226PEF1
Domain Number 1 Region: 74-122
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 2 Region: 35-77
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000235
Family Somatomedin B domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A226PEF1
Sequence length 274
Comment (tr|A0A226PEF1|A0A226PEF1_COLVI) Uncharacterized protein {ECO:0000313|EMBL:OXB78433.1} KW=Complete proteome; Reference proteome OX=9014 OS=Colinus virginianus (Northern bobwhite) (Tetrao virginianus). GN=H355_007463 OC=Odontophoridae; Colinus.
Sequence
MPPPPLLLFLLLLPALHPAAAGCAALGLCCPGRSPSCRSTGWRPDGSHGPCYCDQACEHT
LDCCHDYSQACPVIPCVVSQWSVWSGCAEPCKTTYRVRRRHIIQEPQNGGEACPALEERA
GCVEYWTEQGTECKQSLIPALITTGGFGKARRKRAAADGNEGAGYCVEFQLVAITQGCLH
SHHTYTHWMQYLREGHIVCVECQHPALDSESLHCYGDGSGSKRPGMSLSIKSTGEHRVQL
NTFLLSTDVSVSLMGSSKPEPVTISASQVWGQVL
Download sequence
Identical sequences A0A226PEF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]