SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226PVR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226PVR9
Domain Number 1 Region: 693-768
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000153
Further Details:      
 
Domain Number 2 Region: 624-698
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 1050-1126
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000144
Further Details:      
 
Domain Number 4 Region: 973-1049
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000104
Further Details:      
 
Domain Number 5 Region: 192-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.28e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000115
Further Details:      
 
Domain Number 6 Region: 483-553
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.3e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.000028
Further Details:      
 
Domain Number 7 Region: 391-478
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000432
Further Details:      
 
Domain Number 8 Region: 1121-1198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.01e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000722
Further Details:      
 
Domain Number 9 Region: 548-623
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.04e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 10 Region: 867-919,949-972
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.79e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 11 Region: 336-410
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000964
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 12 Region: 799-875
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 13 Region: 264-339
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226PVR9
Sequence length 1269
Comment (tr|A0A226PVR9|A0A226PVR9_COLVI) Uncharacterized protein {ECO:0000313|EMBL:OXB83497.1} KW=Complete proteome; Reference proteome OX=9014 OS=Colinus virginianus (Northern bobwhite) (Tetrao virginianus). GN=H355_006344 OC=Odontophoridae; Colinus.
Sequence
MRPPRSLSNPTGKGTWGRDRRSAEPEVLFELFCPCGIPGLCVGGKSTMSSVAVLTQESFA
EHRSGLAQQQVKVTALNSEEENDPPTYKEAFPPLPEKAPCLEAAQEPSGPWSKIRPIKAS
VITQVFHVPLEERKYKDMNQFGEGEQAKICLDIMQKTGAHLELSLAKDQGLSIMVSGKLE
AVMKARKEIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSN
QIKITGTKEGIEKARHEILLISAEQDKRAVERLDVEKVYHPFIAGPYNKLVSELMQETGT
RINIPPPSVNKTEIVFTGEKEQLAQAVARVKKIYEEKKKKTTTIAVEVKKSQHKYVIGPK
GNSLQEILEKTGVSVEIPPTDSSSETVILRGEPEKLGQALTEVYAKANSFTVSSVSAPSW
LHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEVMVKDLINR
MDYAEINVDHKFHRHLIGKNGANINRIKDLYKVSVRIPPDNDKSNLIRIEGDPQGVQQAK
KELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAHKSDIV
QLRGPKNEVEKCTKYMQKMVADLVENSFSISVPIFKQFHKNIIGKGGANIKKIREESNTK
IDLPAENSNSETIVITGKRANCEAARHRILAIQKELANITEVEVSIPSKLHNSLIGAKGR
FIRSIMEECGGVHIHFPTEGSGSDTVTIRGPAQDVEKAKKQLLHLAEEKQTKSYTVDLRA
KPEYHKFLIGKGGGNIRKDNVVEDSMVVDPKHHRHFVIRRGQVLREIADEYGGVMVSFPR
SGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTIECTIPQKFHRSIMGPKGSRIQQI
TRDYGVQIKFPDREENPAPVAEPVLQENGEESGEGKDGKDAEPSSPKKCDIIIISGRREK
CEAAKEALQALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPAPELQSDIIT
ITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLTVTVDPKYHPKIIGRKGAVITQIR
TEHEVNIQFPDKDDESQAQDQITITGYEKNAEAARDAIMKIVGELEQMVSEDVTLDHRVH
ARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLA
DVVDNEAMQVYMKPSSHEESKAPSKGFVVRDAPWATVNNEKAPDMSSSEDFPSFGAQVAP
KTLPWGPKR
Download sequence
Identical sequences A0A226PVR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]