SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A229Z0A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A229Z0A8
Domain Number 1 Region: 69-245
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.97e-21
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00041
Further Details:      
 
Domain Number 2 Region: 374-384,435-547
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000392
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A229Z0A8
Sequence length 630
Comment (tr|A0A229Z0A8|A0A229Z0A8_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OXN38062.1} KW=Complete proteome OX=1245748 OS=Aspergillus turcosus. GN=CDV55_02346 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPGMAVGLRPDSSEESGALAGVASKSPLPTEMEIDGETEERSTRHSAIPHNGSNEAAEDV
AISSKRRRRRILLSTESAFVDNILPSLVQNPDIELRLITDEPSALLAGANKIPHYMDTVD
SQTFEKKTGARRWLKAKAAELSEWADMLLVAPIDAGALGSMLFGLTNTLTLALLRGWISS
KPVILIPGMTVSEWEHPLSSRQLAEVDRYWPWINIVKPALWRSNGPEELVQLHWDGLGEL
HDTMERTLGLSFAESSTISGQALDNTQPVTPSATKQSASAISAAQHLRKGARSLPYELWL
NIFEEQLQDWEIAKAVGIPTNLPVPKEWQSHLLKMSTPASLEYTILRGSFAAIKKRIDSL
PRWKPLSDLACHLIFKFSRTDVLSYLTENHLDMLWTTSRLTKLPYRASAIYGNPKILTWW
QEAPALPNKDYSADAMDGASRAGFVEVLEWWRTSGLELRYTERALESASAEGRVAVLEWW
KNASANAPPSNPIPLKVGKSVLLAAQSGRVESLAWWDASGIPYSHAESIARIASTHGHVH
VLDFWYRLKGPKMIFDSQLLVGPTKNGHDNVLEWWRRSGLRVEFKTCDIEEALEDADPVS
GAEGRVRRWWARNGLNLGVGTSEWMKTKVL
Download sequence
Identical sequences A0A229Z0A8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]