SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A235HSE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A235HSE7
Domain Number 1 Region: 351-687
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.15e-45
Family Patatin 0.0000505
Further Details:      
 
Domain Number 2 Region: 9-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-27
Family Laminin G-like module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A235HSE7
Sequence length 699
Comment (tr|A0A235HSE7|A0A235HSE7_9NOSO) Patatin {ECO:0000313|EMBL:OYD88065.1} KW=Complete proteome; Reference proteome OX=2014530 OS=Nostoc sp. 'Peltigera membranacea cyanobiont' 213. GN=CDG77_25715 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MINLVNTQTVLTFDGVNDYIDFGRNDIGGVFAQGSSAFTVSGWVNPHELTNKATSYGTRN
VFFARSSERFSDNFEFGISETGSLDVYIDESVNKNIKTFGQGELTIGQWHFVAIVFNSGQ
LTVYLDDRQYSDSLRGSSLNKATSSITLGATLHKQVYFKGQLANISVWNSPCTQAQIQTH
RCGLIVGDESGLVAYWKLDDGQGTTVKNQAGKSYQGNFRGNPIWTLAEIPFATQSSNPVP
FAAELSNQEDIQLEEIQTETAVIPEENISPLTTSLLAATVSLVSDDENQPKEIQQTQTNS
EESEIIPTARALEPHDEETKADQTEDPVNIQQAQILTQEESPETMNTEARPKYKILSIDG
GGIRGIIPALLLSEIERRTQKPIFSLFDLITGTSSGGILALGLTKPRLSSDVSDNLPVAE
YTGEDLLQFFLEYGVEIFYEPLFERLLGPLEDIFLQPKYPSESKEEIFRKYFGNALIENN
LKEVFVTSYDIEQRIPIFFTNKLEKQQIESKNFQKLCGGFSLLDAALATSATPTYFAPHR
IVNPHNSGIAYTLIDGGVFANNPAHLAILEAQISSKQKAQKLLNTEDILVVSLGTGSLTS
VYPYKEVKNWGLLQWGRPLLNIMFDGSSEVVAGELEQLFEPSEKEAQSFYYRFQTLLDSE
LEEIDNTKLQNTRQLQAIAHRLISNKSQQIDELCSLLLG
Download sequence
Identical sequences A0A235HSE7
WP_094332161.1.22193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]