SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250E1C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A250E1C3
Domain Number - Region: 45-87
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.08
Family Regulator of G-protein signaling, RGS 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A250E1C3
Sequence length 191
Comment (tr|A0A250E1C3|A0A250E1C3_GEOSE) Fimbrial protein {ECO:0000313|EMBL:ATA60835.1} KW=Complete proteome OX=1422 OS=Geobacillus stearothermophilus (Bacillus stearothermophilus). GN=GS458_2396 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MIVDINLLPRKEPRRAAGAVLAAFAVLLLLLGAGGGYWLMERANQRLAALEGELRQVRAE
QAAMEAKGKTTEQQQAEQELAKAVEWANRYPLKTVPLLRALAKQLPERGFIMNFSYAGQK
TVTMTVQFDAAEEAAYYLDRLEEVHLVKAVKLTGISASGESGGAEGETIVPRYIAQYELE
LQPTGKEGDNE
Download sequence
Identical sequences A0A0E0TEA3 A0A0K2H755 A0A250E1C3 L8A105
gi|448238902|ref|YP_007402960.1| gi|261418361|ref|YP_003252043.1| gi|297529213|ref|YP_003670488.1| gi|319767680|ref|YP_004133181.1| 544556.GYMC61_0894 WP_013144607.1.17728 WP_013144607.1.46340 WP_013144607.1.50933 WP_013144607.1.59104 WP_013144607.1.80994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]