SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250W7Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250W7Z2
Domain Number 1 Region: 22-191
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000258
Family HAT/Suf repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A250W7Z2
Sequence length 440
Comment (tr|A0A250W7Z2|A0A250W7Z2_YEASX) SnoRNA-binding rRNA-processing protein {ECO:0000313|EMBL:GAX66988.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_0089 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSKTRYYLEQCIPEMDDLVEKGLFTKNEVSLIMKKRTDFEHRLNSRGSSINDYIKYINYE
SNVNKLRAKRCKRILQVKKTNSLSDWSIQQRIGFIYQRGTNKFPQDLKFWAMYLNYMKAR
GNQTSYKKIHNIYNQLLKLHPTNVDIWISCAKYEYEVHANFKSCRNIFQNGLRFNPDVPK
LWYEYVKFELNFITKLINRRKVMGLINEREQELDMQNEQKNNQAPDEEKSHLQVPSTGDS
MKDKLNELPEADISVLGNAETNPALRGDIALTIFDVCMKTLGKHYINKHKGYYAISDSKM
NIELNKETLNYLFSESLRYIKLFDEFLDLERDYLINHVLQFWKNDMYDLSLRKDLPELYL
KTVMIDVTLNIRYMPVEKLDIDQLQLSVKKYFAYISKLDSTSVKSLKNEYRSYLQDNYLK
KMNAEDDPRYKILDLIISKL
Download sequence
Identical sequences A0A250W7Z2 G2WBI0
YDR449C YDR449C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]