SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250W839 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250W839
Domain Number 1 Region: 42-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.1e-23
Family Thioltransferase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A250W839
Sequence length 143
Comment (tr|A0A250W839|A0A250W839_YEASX) Dithiol glutaredoxin {ECO:0000313|EMBL:GAX66931.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_0032 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
METNFSFDSNLIVIIIITLFATRIIAKRFLSTPKMVSQETVAHVKDLIGQKEVFVAAKTY
CPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNVYINGKHIG
GNSDLETLKKNGKLAEILKPVFQ
Download sequence
Identical sequences A0A0L8VU53 A0A250W839 A6ZZA0 B3LFF7 C7GKU6 E7KMB5 E7LTD6 E7Q2T2 E7QDH5 G2WBP0 H0GEU0 P17695
YDR513W SCRT_00030 4932.YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W NP_010801.1.97178 YDR513W YDR513W YDR513W tr|A6ZZA0|A6ZZA0_YEAS7 YDR513W YDR513W YDR513W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]