SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250W935 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250W935
Domain Number 1 Region: 300-611
Classification Level Classification E-value
Superfamily TPR-like 6.96e-98
Family Tetratricopeptide repeat (TPR) 0.00000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A250W935
Sequence length 612
Comment (tr|A0A250W935|A0A250W935_YEASX) Peroxisomal membrane signal receptor for peroxisomal matrix proteins {ECO:0000313|EMBL:GAX67172.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_0273 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MDVGSCSVGNNPLAQLHKHTQQNKSLQFNQKNNGRLNESPLQGTNKPGISEAFISNVNAI
SQENMANMQRFINGEPLIDDKRRMEIGPSSGRLPPFSNVHSLQTSANPTQIKGVNDISHW
SQEFQGSNSIQNRNTDTGNSEKAWQRGSTTASSRFQYPNTMMNNYAYASMNSLSGSRLQS
PAFMNQQQSGRSKEGVNEQEQQPWTDQFEKLEKEVSENLDINDEIEKEENVSEVEQNKPE
TVEKEEGVYGDQYQSDFQEVWDSIHKDAEEVLPSELVNDDLNLGEDYLKYLGGRVNGNIE
YAFQSNNEYFNNPNAYKIGCLLMENGAKLSEAALAFEAAVKEKPDHVDAWLRLGLVQTQN
EKELNGISALEECLKLDPKNLEAMKTLAISYINEGYDMSAFTMLDKWAETKYPEIWSRIK
QQDDKFQKEKGFTHIDMNAHITKQFLQLANNLSTIDPEIQLCLGLLFYTKDDFDKTIDCF
ESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNLAVSSMNIGC
FKEAAGYLLSVLSMHEVNTNNKKGDVGSLLNTYNDTVIETLKRVFIAMNRDDLLQEVKPG
MDLKRFKGEFSF
Download sequence
Identical sequences A0A250W935 G2WAY7
YDR244W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]