SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250W947 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250W947
Domain Number 1 Region: 61-200
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-50
Family Ran-binding domain 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A250W947
Sequence length 201
Comment (tr|A0A250W947|A0A250W947_YEASX) Ran GTPase-binding protein {ECO:0000313|EMBL:GAX67388.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_0489 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSSEDKKPVVDKKEEAAPKPPSSAVFSMFGGKKAEKPETKKDEEDTKEETKKEGDDAPES
PDIHFEPVVHLEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTN
KVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGS
KENADKFKEEFEKAQEINKKA
Download sequence
Identical sequences A0A250W947 A6ZXW7 B3LGQ7 B5VFR2 C7GXY9 E7KAP0 E7NGM6 E7Q210 E7QCN2 G2WCF5 N1P601 P41920
YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W SCRT_00506 YDR002W YDR002W YDR002W NP_010285.1.97178 tr|A6ZXW7|A6ZXW7_YEAS7 NYSGXRC-P033 YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W 4932.YDR002W YDR002W YDR002W YDR002W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]