SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250WA99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A250WA99
Domain Number - Region: 312-378
Classification Level Classification E-value
Superfamily TPR-like 0.00196
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A250WA99
Sequence length 685
Comment (tr|A0A250WA99|A0A250WA99_YEASX) Anaphase promoting complex subunit 5 {ECO:0000313|EMBL:GAX67735.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_0836 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSKYGPLGITNFITPYDLCILILIHAHCSQDNGISVPTAVFLRLISPTRPSLEWNPLLKD
NSNLRSSSVVPPPVLPILDNIIRILLDDKDGNKIALTLMGYLEAINGLDSINRLMMDLEK
NCLVNNYRSMKMRTTSTRRQMTRASFLGTFLSTCIRKYQIGDFEMRETIWINLQNFKTVF
MHTPLWLRFKDNIHIQKVKNCLLANDEISVEDQQMVEFFQHFNNGNDADSKTMNEENYGT
LISIQHLQSIVNRQIVNWLDNTEFNLMGQEETSSTYEEQCGLVFDLLDTLSLNDATKFPL
IFILKYLEAIKENSYQTALDSLHNYFDYKSTGNSQNYFHISLLSLATFHSSFNECDAAIN
SFEEATRIARENKDMETLNLIMIWIINFIEVHPEYANRFYITVEQIIKYLKNSSDVEDAN
IFSNAYKFETLLSMVKESKTAEVSSSLLKFMAITLQNMPSQNFDLFQSLVSYEVKFWKEL
GYESISDVYEKFLSKTSSSSLRNYDSSIINQDIKVAFKALEEDDFLKVKQYLLKSESLKL
DYDQKINLKYLRVKYLVKIGDYDLSMRLINQYVKECCEEVADSNWRFKFEIESINVLLLS
DVGIRGLPKIIKLIDKYKEIGNPLRCVILLLKLCEVLIQVGKSMEAECLISCNLSTILEF
PFVRKKTDELLESLSVEEDRDVQMT
Download sequence
Identical sequences A0A250WA99
YOR249C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]