SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250WDS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250WDS5
Domain Number 1 Region: 124-427
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.45e-71
Family WD40-repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A250WDS5
Sequence length 451
Comment (tr|A0A250WDS5|A0A250WDS5_YEASX) mRNA splicing protein {ECO:0000313|EMBL:GAX68710.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_1811 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MDGNDHKVENLGDVDKFYSRIRWNNQFSYMATLPPHLQSEMEGQKSLLMRYDTYRKESSS
FSGEGKKVTLQHVPTDFSETSQAVISKKDHDTHASAFVNKIFQPEVAEELIVNRYEKLLS
QRPEWHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAG
HVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIA
TAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKT
MKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQ
DDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEAD
KSIKIWKQDETATKESEPGLAWNPNLSAKRF
Download sequence
Identical sequences A0A250WDS5 G2WP32
5lj3_J 6exn_J YPL151C YPL151C YPL151C YPL151C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]