SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250WEB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250WEB3
Domain Number 1 Region: 24-69
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000849
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A250WEB3
Sequence length 211
Comment (tr|A0A250WEB3|A0A250WEB3_YEASX) Zinc finger DNA binding transcription factor {ECO:0000313|EMBL:GAX69164.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_2265 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MRGKQPKRNKDNASVKRNYRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFS
RIDNLRQHQSSVHSDVDLMSLRRLQQSANSTANDPNATRMFPQLRPYGIVVQPAPVPYNL
PISTPASPQNTISLYAPPYFPHPMPSAPIPLPHQPPPLPIYSYMQPLFLNHTPIQNHNIV
ELPPDSSDTPASPSKVQSFDQAKDASPNAKK
Download sequence
Identical sequences A0A250WEB3 A6ZMP2 C7GTR9 G2WKN6 H0GL92
YMR182C YMR182C YMR182C YMR182C YMR182C YMR182C tr|A6ZMP2|A6ZMP2_YEAS7 YMR182C YMR182C YMR182C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]