SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250WJH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250WJH2
Domain Number 1 Region: 116-386
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.25e-46
Family WD40-repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A250WJH2
Sequence length 401
Comment (tr|A0A250WJH2|A0A250WJH2_YEASX) Subunit of the Hat1p-Hat2p histone acetyltransferase complex {ECO:0000313|EMBL:GAX70866.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_3967 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI
IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE
ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS
DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA
NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN
LEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL
NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDIIS
Download sequence
Identical sequences A0A250WJH2 A6ZQP5 C7GXE3 G2WCH8 N1P3J0 P39984
tr|A6ZQP5|A6ZQP5_YEAS7 YEL056w___KOG0264 YEL056W YEL056W YEL056W YEL056W YEL056W YEL056W 355030 NP_010858.3.97178 YEL056W YEL056W YEL056W 4932.YEL056W YEL056W YEL056W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]