SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250WMF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250WMF7
Domain Number 1 Region: 61-429
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-34
Family WD40-repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A250WMF7
Sequence length 431
Comment (tr|A0A250WMF7|A0A250WMF7_YEASX) Specific chaperone for ribosomal protein Rpl10p {ECO:0000313|EMBL:GAX71995.1} OX=4932 OS=Saccharomyces cerevisiae (Baker's yeast). GN=SCKG_5096 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MEPQEEFITTEEVEQEIVPTVEVEQDVPVDIEGENDDDDEMMNDDEEALEVDMSNNSLTY
FDKHTDSVFAIGHHPNLPLVCTGGGDNLAHLWTSHSQPPKFAGTLTGYGESVISCSFTSE
GGFLVTADMSGKVLVHMGQKGGAQWKLASQMQEVEEIVWLKTHPTIARTFAFGATDGSVW
CYQINEQDGSLEQLMSGFVHQQDCSMGEFINTDKGENTLELVTCSLDSTIVAWNCFTGQQ
LFKITQAEIKGLEAPWISLSLAPATLTKGNSGVVACGSNNGLLAVINCNNGGAILHLSTV
IELKPEQDELDASIESISWSSKFSLMAIGLVCGEILLYDTSAWRVRHKFVLEDSVTKLMF
DNDDLFASCINGKVYQFNARTGQEKFVCVGHNMGVLDFILLHPVANTGTEQKRKVITAGD
EGVSLVFEVPN
Download sequence
Identical sequences A0A0L8VNX0 A0A250WMF7 C7GJG0 E7KPZ4 G2WGF8
YIR012W YIR012W YIR012W YIR012W YIR012W YIR012W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]