SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250X1Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250X1Z5
Domain Number 1 Region: 210-296
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.13e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 115-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.00084
Further Details:      
 
Domain Number 3 Region: 287-367
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000775
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 4 Region: 481-520
Classification Level Classification E-value
Superfamily WW domain 0.000000000608
Family WW domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A250X1Z5
Sequence length 522
Comment (tr|A0A250X1Z5|A0A250X1Z5_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:GAX77113.1} KW=Complete proteome OX=1157962 OS=Chlamydomonas eustigma. GN=CEUSTIGMA_g4559.t1 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MAAVPEVPVFAHEVQEPPHNDAPPGDSSYTEIPPGDDYPAAIDPASAYMANGADDAGASA
EVLRAKAAALAAQFAANHSADDQDGKRKFESGYEEDPAAKRSHSEAPIMPFFGGEPSDTM
QVPSGKVGKIIGKGGVTIKDISARGGGKIKIDHETPGETKTVTISGTQEQIRMTKQLIQD
AIDSTEFPGAGNAFGGQGGYGAPGTGGGSETRKVSCPAHIVGRIIGRGGETIRSLQTAST
AHIVINQDFPEGHPREVLISGTPDAVNRAHEMVNELINSEGAASTQTVIQKFGQGVSKVI
ECPKHMVGRIIGKGGETVKGLQRQYAASIQIEQNIVPCKVTLTGPAHAVASLERAVMELI
EDRPMGGPGGFGGGGRPPFQQPFPAAPYGGFPTPGYGGYGAPAAYGGYPAPGFGGYPGYG
APQVPQAFGGYGGGYNNADPYAAAAAAAAGAYGGAAAAGGYPGQQQQQQQQQQQQQPQQQ
QQQQPVANAGGLWSEMKDDQGRSYYYNSQTGVSQWERPAEMH
Download sequence
Identical sequences A0A250X1Z5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]