SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A250Y7D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250Y7D0
Domain Number 1 Region: 411-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 622-665
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000322
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 3 Region: 383-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000105
Family EGF-type module 0.008
Further Details:      
 
Domain Number 4 Region: 742-853
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 5 Region: 350-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000336
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 658-698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000163
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 311-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000127
Family EGF-type module 0.017
Further Details:      
 
Domain Number 8 Region: 702-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A250Y7D0
Sequence length 1235
Comment (tr|A0A250Y7D0|A0A250Y7D0_CASCN) Delta-like protein {ECO:0000256|RuleBase:RU280815} OX=51338 OS=Castor canadensis (Beaver). GN=JAG2 OC=Castoridae; Castor.
Sequence
MRARGRGRLPRRLLLLLLALWVQAARPMGYFELQLSALRNVNGELLNGACCDGDGRTTRA
GGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARS
RAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWK
SLHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKE
CKEAVCKQGCNLLHGGCSVPGECRCSYGWQGKFCDECVPYPGCVHGSCVEPWHCDCETNW
GGLLCDKDLNYCGSHHPCINGGTCINAEPDQYHCTCPDGYSGKNCERAEHACASNPCANG
GSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPQQWVGTT
CQLDINDCHGQCQHGGTCKDLVNGYQCVCPRGFGGRHCELERAECASSPCRGGGICEDLW
NGFRCHCPRGLSGPLCEVNVDLCEPSPCLNGARCYNLEGDYYCACPEDFGGKNCSVPREQ
CPGGACRVIDGCGVEAGSRVPGMAPSGVCGPHGHCVSQPGGNFSCVCDSGFTGTYCHESE
WCTQQVGVGVAGLGTAHLLSPTDIDDCLGQPCRNGGTCIDEVDSFRCFCPSGWEGELCDT
NPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDT
FRCACPPGWKGSTCTIAKNSSCLPNPCVNGGTCVGSGDSFSCICRDGWEGRTCTHSTNDC
NPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSC
PPGRTGPRCQDVVEFGRSCWSRGMPFPHGSSWVEDCNTCRCLDGHRDCSKVWCGWKPCLL
SGQPDALNTQCPPGQQCQEKSPGQCLQPPCEAWGECGAEEPLPPNTPCLPRAGYLDNNCA
RLTLRFSRDQLPQGTTVGSICSGIRSLPATRAVARDRLLLLLCDRASSGASAVEVAMSFS
PARDLPDSSLIQSAAHAIVAAITQRGNNSLLLAITEVKVETVVVGGSSTGLLVPVLCSVF
SVLWLTCVVICVWWTRKRRKERERSRLPRDESTNNQWAPLNPIRNPIERPGGSGPGGGGH
KDVLYQCKNFTPPPRRAGEALPGPVGHGGGGEDEEDEELGRGDEDSPEAEKFLSHKFTKD
PSCSPGRPTRWVASGPKVDNRAVRSIKDMHCAGKE
Download sequence
Identical sequences A0A250Y7D0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]