SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A251WNN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A251WNN5
Domain Number 1 Region: 15-100
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000301
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A251WNN5
Sequence length 183
Comment (tr|A0A251WNN5|A0A251WNN5_9FIRM) SMI1/KNR4 family protein {ECO:0000313|EMBL:OUC50545.1} KW=Complete proteome OX=31973 OS=Eggerthia catenaformis. GN=B7939_11075 OC=Erysipelotrichaceae; Eggerthia.
Sequence
ALADGSLAAEPRLRQLALAEAAQDGDIDLLQRLRDAGCDFAETLRGRGGVLEACLARGRL
EAARWLLDQGVAVHQDSLQIGAAHLDAVLAERLLRLGAISDPNTVLLALQYGDADAARIM
ARPLLEEAPARASALRLALASRAERERSDARRVRSGKMGSNRSPDDYLALAERLERFLAE
LPG
Download sequence
Identical sequences A0A251WNN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]