SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A252E7L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A252E7L5
Domain Number 1 Region: 227-392
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.37e-42
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 7-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-31
Family KaiB-like 0.00084
Further Details:      
 
Domain Number 3 Region: 148-234
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000432
Family Homodimeric domain of signal transducing histidine kinase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A252E7L5
Sequence length 395
Comment (tr|A0A252E7L5|A0A252E7L5_9NOSO) Synechococcus adaptive sensor protein A {ECO:0000256|HAMAP-Rule:MF_01837} KW=Complete proteome OX=1932621 OS=Nostoc sp. T09. GN=BV372_10335 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MPVSQDQPISSDAPLQLLLFVDGRPKSRQQVQRIRAYLKELQTEYHFELQIIDVGQQPYM
AEHFKLVATPALIKIHPEPRQIIAGSNIIGQLKNWWPRWQASVDAYLKLQEDLQERLDEN
ARMVSPKSTISSVAVSAELIRLSDEIFRLKQEQEKLQEQLQFKDRVIAVLAHDLRNPLTA
AAIAIETLQSNYNIETGQFQRLKPAMTAHLLKQARTQTKTIDRMITDLLQVGRGNDTELP
IVPQKMEIGKLCLDVVEELRDRYTAKSQQIETDVPQDLPYVYADPERIHQVLVNLLDNAI
KYTPAGGKISLAGLHRTTQKVQISIGDTGPGIPYENRDRIFENHFRLQRDEGTEGYGIGL
CVCQRIIRAHYGQIWVDSVPNAGAWFHFTLPVYPS
Download sequence
Identical sequences A0A252E7L5
WP_086686407.1.22335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]