SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267DCG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267DCG5
Domain Number 1 Region: 101-227
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-30
Family Cadherin 0.00072
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 623-773
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000334
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 4 Region: 864-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000021
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 779-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 821-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000689
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A267DCG5
Sequence length 1361
Comment (tr|A0A267DCG5|A0A267DCG5_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA46968.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig000184g4 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MDVNDNPPRFANASLEASLSELTPVGHRVLRLHADSADSGANAEIRYRLLDNDGLFSVDA
VSGELTLKSPLDYEQRREYHLTIRAFDTSSRPLSATAVVTVRVLDENDNAPQFPPGGFNV
TARENADPGTRLPVDIAATDADSGDNGRLAYQIRAGDPDGMFSLDSASGRFYARRRLDRE
TQELYSLTVTAADHGRPPFTATTTVRVTVLDQNDCSPQFDRPDYSFIAQVDDSGNITQQP
YLEDTDPEDPTASLIRVTDCDAPPNGGPFVWSVVEGNSMKFAVSSGRLRISEAFPQPLGV
ELIRIQACDGGDVIRCGSAQASIRTVRTQSAPPRVLPQNLTAVFAEPPAPGLRLGGVTLA
GGRQLEDSNVRLRLASHADRFELGRAGDLLVSNGNLAASRTDYRLRVRAETLNGLRSAQE
LRLRLVMATEDMTRNAVCLRVSNESGFSFVFSGLESVTREAISQQLRIDSDDAFVLGLQS
ASDVKGDVPGSSDDLLVVVAAYDRRDRRYLTRAELTARLSADRLASALGGGGRRVGIAAA
DAAGLCPLEARLATPPTPAAVRLVTARASFLAPRFHLLPPPATDGCWRGGRLSPAAKAQP
PMAAVHAQGEARAVWSLDSGLQSLRLQLRTVQTQPGPVLTLRTAGGQREVLQLRLRADGR
LSVGSPAAAGAADDSSAELAAARLPVNDGRWHSAEVRLLRPADGSPTAVQLLVDSIDPQF
ANLPADSALAARGSHEVAIGRGFNGCLRDMRGPTTAPRLRLSGASKGLRPGCSDSLLAAP
CAKTPCLHGGACESGSSTGSGAFSCRCPSPYVGARCEVNAEPCASAAAASRCRNGGRCRS
GPALGQAVCDCAGTGFQGDTCEADIDECRSVPPPGPCSGRGVCRNLPGGFHCNCTSGFAG
PTCAGLPGDSTDGSASVATASFSPLEVATVAGSALLLVVLAFIVFLCVSCLCRRRSGASG
SGGSGRRRKSRGGRNGNCNGNGSPASAYGCELHDPSEAVALVTLASGETRLVPQKELGSL
GVGMGPLGSAGPSPTYACYERPRPPSSTAATAIGNGRYPSQLVAESAAGTPTRCLTPRGG
GGGYPPRFPQVRLPASSGVGEVGGGLGDFLIDEQGGRAAPCGHGWQCSCWIRRGYHWDTS
DWNPAANPPDLIPDHSPYCVYSGPNGLQYFSHGRCNGGVAGSSGLSSPANHHHHHQHHQH
HQFLRPANSLLLSASASASVAGSLRGIGGGGGGGGGRCCSRCGGAGGVGGSFESLGSALS
SSQQQQQLRARGPASPQLLPPLDADGEAEVAAADAGSQVALLPPAPVAASPSASTASPAS
TTIAAVAAFAASPPALIESPAEDVDDAVAMATAAQPAETAA
Download sequence
Identical sequences A0A267DCG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]