SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267FMI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267FMI3
Domain Number 1 Region: 41-301
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.81e-57
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 278-375
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000414
Family Ankyrin repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 388-436
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000327
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A267FMI3
Sequence length 463
Comment (tr|A0A267FMI3|A0A267FMI3_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA75010.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig034199g2 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
QSRIAGYSTVARQTDLQRLGMLNSGGAGGASGGAEQAAIHFYDAIIQNDMDALRRAVEVF
KVDLNAKFTLVRKQHHFDLFPVHLVAYKGYLSMLHYLIQTGVAVNQTTATLHRHAVHYAA
LRSQLSCLQMLVNAGGKIDARDTFGNTPLHYAAEDGNVILMSLLLHNGASLDAQDITNKT
PLMKATRNGKLAAVKRLTAAGASVNLKDKNEDTALHFAARHGSGEMTCMLIRAEARVDAQ
NQWGLTPLMEAVSYNQKEVVAALIKHRCDLYKRDFRTGDTSLHIAVKKNYTDLVSMLLSA
GNWYIQYNFNNFGESFVHDVVVYNRMDLLRLFVTYNYNFDYPAKKTPTGVEKLPFQLVLE
RGHLEMAKILAQVGCYSSSRFCQSSVRRCPELESVKSLRSWARKTIRDQLGFSPGGKINK
LPVPTMVKDFLLLKDVKWDTRLPQQQQQQQQQQQQGLSENMSS
Download sequence
Identical sequences A0A267FMI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]