SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267FTW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267FTW3
Domain Number 1 Region: 101-226
Classification Level Classification E-value
Superfamily Cadherin-like 2e-30
Family Cadherin 0.00076
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 623-772
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000134
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 4 Region: 864-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000986
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 5 Region: 779-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 821-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000958
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A267FTW3
Sequence length 1359
Comment (tr|A0A267FTW3|A0A267FTW3_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA77193.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig000184g5 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MDVNDNPPRFANASLEASLSELTPVGHRVLRLHADSADSGANAEIRYRLLDNDGLFSVDA
VSGELTLKSPLDYEQRREYHLTIRAFDTSSRPLSATAVVTVRVLDENDNAPQFPPGGFNV
TAKENADPGTRLPVDIAATDADSGDNGRLAYQIRAGDPDGMFSLDSASGRFYARRRLDRE
TQELYSLTVTAADHGRPPFTATTTVRVTVLDQNDCSPQFDRPDYLFIAQVDDSGNITQQP
YLEDTDPEDPTASLIRVTDCDAPPNGGPFVWSVVEGNSMKFAVSSGRLRISEAFPQPLGV
ELIRIQACDGGDVIRCGSAQASIRTVRTQSAPPRVLPQNLTTVFAEPPAPGLRLGGVTLA
GGRQLEDSNVRLRLASHADRFKLGRAGDLLVSNGNLAASRTDYRLRVRAETLNGLRSAQE
LRLRLVMATEDMTRNAVCLRVSNESGFSFVFSGLESVTREAISQQLRIDSDDAFVLGLQS
ASDVKGDVPGSSDDLLVVVAAYDRRDRRYLTRAELTARLSADRLASALGGGGRRVGIAAA
DAAGLCPLEARLATPPTPAAVRLVTARASFLAPRFHLLPPPATDGCWRGGRLSPAATAQP
SMAAVHAQGEARAVWSLDSGLQSLRLQLRTVQTQPGPVLTLRTAGGQREVLQLRLRADGR
LSVGSPAAAGAADDSSAELAAAGLPVNDGRWHSAEVRLLRPADGSPTAVQLLVDSIDPQF
ANLPADSALAARGSHEVAIGRGFNGCLRDMRGPATAPRLRLSGASKGLRPGCSDSLLAAP
CAKTPCLHGGACESGSSAGSGAFSCRCPSPYVGARCEVNAEPCASAAAASRCRNGGRCRS
GPVLGQAVCDCAGTGFQGDTCETDIDECRSVPPPGPCSGRGVCRNLPGSFHCNCTSGFAG
PTCAGLPGDSTDGSASVATASFSPLEVATVAGSALLLVVLAFIVFLCVSCLCRRRSGASG
SGGSGRRRKSRGGRNGNCNGNGSPASAYGCELHDPSEAVALVTLASGETRLVPQKELGSL
GVGMGPLGSAGPSPTYACYERPRPPSSTAATAIGNGRYPSQLVAESAAGTPTRCLTPRGG
GGGYPPRFPQVRLPASSGVGEVGGGLGDFLIDEQGGRAAPCGHGWQCSCWIRRGYHWDTS
DWNSAANPPDLIPDHSPYCVYSGPNGLQYFSHGRCNGGVAGSSGLSSPANHHHHHHQHHQ
FLRPANSLLLSASASASVAGSLRGIGGGGGGGGGRCCSRCGGVGGVGGSFESLGSALSSS
QQQQQLRARGPASPQLLPPLDADGEAEVAAADAGSQVALLPPAPVAASPSASTASPASTT
IAAVAAFAASPPALIESPAEDVDDAVAMATAAQPAETAA
Download sequence
Identical sequences A0A267FTW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]