SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286UW32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286UW32
Domain Number 1 Region: 104-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000492
Family UAS domain 0.038
Further Details:      
 
Domain Number 2 Region: 316-397,423-457
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000749
Family UBX domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A286UW32
Sequence length 483
Comment (tr|A0A286UW32|A0A286UW32_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:PAV23809.1} KW=Complete proteome; Reference proteome OX=418867 OS=Phellinus noxius. GN=PNOK_0087700 OC=Agaricomycetes; Hymenochaetales; Hymenochaetaceae; Phellinus.
Sequence
MSALASFLGSLVRAFLYPFTTSFTFIQRLFLYLTSWASTSPKRHVADDPVSVADRWVREL
EEETGAIRESRLSGYDTYATGAEAQAGPGPSTLSRRNENARSHRRLIPEFYLGSYESALN
QAKREARFLCVVIVSEEHDDVPEFKRSTLLDSEFNKILKDNHFLVWGGDIRDYEGSQAAQ
KLGTTTYPFVAFVALQPQRSHTRERGSSSSPALTVLSRHQGPSTPVDEDLPISDIGPTSA
RALNAHLTNALLPRVSPFLTRLQAEEAERIAQRRLREEQEIAFARNAEEDRKRILARMEE
EKRQKEEIEMQEIVRAKEEEERKKAIEEREKREQARLLWYRYARRNLLSPENKPGKRSLR
IGIRLPNGLKIRHFSESDSVTSLYVFVASQLIPKEYPVSEDPESPPSGFAPGETGINADN
WSFKLATSFPRREIRWSASTLLTDVNGLQGGAQLVVEAIPGQALIPGNGQNQDEDSDYNT
EED
Download sequence
Identical sequences A0A286UW32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]