SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286X869 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286X869
Domain Number 1 Region: 181-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-31
Family Pentraxin (pentaxin) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A286X869
Sequence length 382
Comment (tr|A0A286X869|A0A286X869_CAVPO) Pentraxin 3 {ECO:0000313|Ensembl:ENSCPOP00000021631} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=PTX3 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MHLRVILLCALWSAASAENSDDYELMYVNMDNEIFDGTHPTEDPTPCDCSREHSEWDKLF
IMLENSQMRESMLLQATDDVLRGELQKLRAELGRLSGSLARPCALAPRRRPGLARTLEEL
LRESRDAGRRLARLESAGVQRPEEEAGRALGAVLEELRRTRADLRAVQGWAARRWLPAGC
ETAILFPMRSKKIFGSVHPVRPMKLESFSACIWVKATDTLNKTIVFSYGTKRNPYEIQLY
LSYQSIVFVVGGEENKLVADTVISLGKWTHLCSTWNSEKGRTSLWAHSELVATAVDMATN
HVVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDHVLSREEIKETGGAESCHI
RGNVVGWGVTEIQPHGGAQYVS
Download sequence
Identical sequences A0A286X869
10141.ENSCPOP00000000162 XP_003476359.1.53824 ENSCPOP00000000162 ENSCPOP00000000162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]