SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286XG63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286XG63
Domain Number 1 Region: 153-461
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.03e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000267
Further Details:      
 
Domain Number 2 Region: 3-72,100-144
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00000000162
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A286XG63
Sequence length 514
Comment (tr|A0A286XG63|A0A286XG63_CAVPO) Seryl-tRNA synthetase {ECO:0000313|Ensembl:ENSCPOP00000024412} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=SARS OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MVLDLDLFRVDKGGNPDLIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGDDDSVPENVLNFDDLTADTLANLKVSQIKNVRLLIDEAILKCDAE
RLKLEAERFENLREIGNLLHPSVPISNDEDADNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAIVAGSRGYFLKGVLVFLEQALIQFALRTLASRNYVPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMIATAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV
EFVHMLNATMCATTRTICAILENYQTEKGIIVPEKLREFMPPGLQELIPFVKPAPIDQEP
SKKQKKQHEGSKKKAATRDVTLENRLQNMEVTDA
Download sequence
Identical sequences A0A286XG63
XP_003479247.1.53824 ENSCPOP00000014167 ENSCPOP00000014167 10141.ENSCPOP00000014167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]