SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286XHX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286XHX3
Domain Number 1 Region: 385-499
Classification Level Classification E-value
Superfamily Anthrax protective antigen 2.09e-18
Family Anthrax protective antigen 0.012
Further Details:      
 
Domain Number 2 Region: 2102-2189
Classification Level Classification E-value
Superfamily E set domains 1.31e-16
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 3 Region: 3199-3232,3266-3387,3416-3537
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.42e-16
Family Pectate lyase-like 0.086
Further Details:      
 
Domain Number 4 Region: 1845-1921
Classification Level Classification E-value
Superfamily E set domains 0.000000000000034
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 5 Region: 1170-1247
Classification Level Classification E-value
Superfamily E set domains 0.000000000000162
Family E-set domains of sugar-utilizing enzymes 0.014
Further Details:      
 
Domain Number 6 Region: 1252-1332
Classification Level Classification E-value
Superfamily E set domains 0.000000000000726
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 
Domain Number 7 Region: 1079-1156
Classification Level Classification E-value
Superfamily E set domains 0.000000000000952
Family E-set domains of sugar-utilizing enzymes 0.037
Further Details:      
 
Domain Number 8 Region: 1925-2007
Classification Level Classification E-value
Superfamily E set domains 0.00000000000196
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 9 Region: 1577-1653
Classification Level Classification E-value
Superfamily E set domains 0.000000000154
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number 10 Region: 2011-2097
Classification Level Classification E-value
Superfamily E set domains 0.00000000031
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.027
Further Details:      
 
Domain Number 11 Region: 1759-1831
Classification Level Classification E-value
Superfamily E set domains 0.00000000171
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 
Domain Number 12 Region: 156-254
Classification Level Classification E-value
Superfamily E set domains 0.00000000233
Family E-set domains of sugar-utilizing enzymes 0.028
Further Details:      
 
Domain Number 13 Region: 1671-1755
Classification Level Classification E-value
Superfamily E set domains 0.0000000056
Family E-set domains of sugar-utilizing enzymes 0.068
Further Details:      
 
Domain Number 14 Region: 1344-1401
Classification Level Classification E-value
Superfamily E set domains 0.0000000056
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 15 Region: 46-137
Classification Level Classification E-value
Superfamily E set domains 0.0000000162
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 
Domain Number 16 Region: 284-344
Classification Level Classification E-value
Superfamily E set domains 0.000000159
Family E-set domains of sugar-utilizing enzymes 0.079
Further Details:      
 
Domain Number 17 Region: 1419-1518
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000112
Family Multidomain cupredoxins 0.084
Further Details:      
 
Domain Number 18 Region: 2497-2694
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000393
Family Galacturonase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A286XHX3
Sequence length 4269
Comment (tr|A0A286XHX3|A0A286XHX3_CAVPO) PKHD1 like 1 {ECO:0000313|Ensembl:ENSCPOP00000025014} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=PKHD1L1 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MNCSVIISLIFSHIYISRNSFFEELCDLTCAILLYLSDGSKIIPRVTEVMPKYGSVNGAT
RLTIKGEGFSQANQFNYGVDNADLGNSVQLVSSFRSITCDVEKDSSHSTQITCYTRPMPE
DSYAVRVSVDGVPIAENNTCKGRINSWACSFNAKNFRTPTIRSITPTSGTPGTLITIQGR
IFTDVYGSNTALSSNGKNVRILRVYVGGMPCELLKPQSDDLYGLKLDHPSGDVGTVVCKV
TGTYVGHHNVSFILDSDYGRSLPQKMAYFVSSLNRISMFQTFAEVTMISPSKGSIQGGAT
LRINSRFFDQTDLPVTVLVGGQPCDILNVTEDSICCKTPPRPHILKTVYPGGRGLKLEVW
NSSQPEQLEEILGYSENTPGYLGATWVDSASYIWPMEHDTFVARFSGFLVAPDSDVYRFY
IRGDDRYAVYFSQTGLPEDKVKIAYHSANANSYFSSPTQRSDDIHLQKGKEYYIEILLQE
YRLSAFVDVGLYQYKSVYTEQQTGDAVNEEQVIKSQSTVIQEVQVITLENWETAIATNEV
QKIIVTSPCVDTNSCSHYQFRLIYNLEKTVWLPADASEVLLQSALNDLWSIKPDTVQVIR
VQSLQHCIYTVTFLSNRGDFDLLAYEVFEGNNVTVDIEEQTKGKPSLETFTLTWDGILSK
PLTPWSSEAEFQVAVEEMVSTKCPPQIAHFEEGFVVKYFRDYETDFDLENVNRGQKTAES
DAYCGRYSLKNPSVLFDSADAKPNRLPYGDILLFPYNQLCLAYKGFLANHIGLKFQYQDN
GKITRSTERQFMYKFAQENSWTYTCLDLLDLIQSKQTGTDFSLQRISLQKASEMQSFYVD
VVYIGQVSTTSTLDEMPKRRLPALASRGIFLKHFQVNESKRDESTMTIQYSVTMTSYNCS
YNIPLMAVSFGQIITSETENESVYRGNNWPGESKIRIRRIQEASPPISGSFDIQAYGHIL
KGIPADVSVADLRFALQSLEEAGQVSVTREGTCAGYAWSIKWRSACGKQSLLQINDSNIV
GEKANMTVTKVKEGGLFRQRILGDLFRTPHQQPQVEVYINGIPAKCSGDCSFTWDPAATP
QVLAISPSQGSYEESTLLTIAGSGFSPSSAVSVSIGSTNCSLLSVEENEIKCQVLKGSAG
RLPVAVSVADVGLARTAHSQGFHFVYQSGISHITPDSGSLAGGTLLTLSGFGFSENSKVL
VGNETCDVIEGNLNRITCRTPKRSEGTVDISVITNGFQATVRNVFRYNCLQTPVITDFSP
KIRTILGDVNLTIKGYNFGNELTQNVVVYVGGKVCQILHWNFTDIRCLLPLLSPGEHSVY
AEVRNWGFASTSDKLNASVQYVLEVTDMFPRRGSLYGGTEITIMGFGFSTIPAENTVLLG
SFPCNVTRSSENAIKCTLHSTRNVFRVTNDGSDLVHGLGYAWSPSVLNVSVGDTVIWHWQ
APPFLRGVGYRVFSVSSPGSVTYDGKGFTNGRQKSISGSFSYQFTSPGIHYYSSGYVDEA
HSISLQGVVNVLPAESRHLPLHLFVSSTEATHIQGGPENLHLGSSGAGCLATEPLCGPND
TRVQNSSIFLFELSSCISPSISNITPSTGTANELITITGSGFSNLTCANKVTIGHYPCVV
EESSANSITCHIDPQDSMEVGIRELVTLVVYNLGTAINTLSHEFDRRFVLLPSIDMVWPN
TGSTTGLTRVIIKGSGFSWAGVEVFMGHFPCKVLTVNYTAVECETSPAPRQLAQVHLLTR
GVPGLCQGSCSFAYSDSITPYITGVSPNTIRGPVKVLIEGAGFGTVLEEIAVLIGNQQFR
AIDVNENNITVLVSSLPAGLHPLRVVVGTKGLALGNLTVSSPMEASVSPSSGSLGGGTML
VITGNGFHPDSTTVTVGEGPCQILFANASEVHCSTPAGRAGKADLQVLVNAVPYPPLPFT
YALEDTPFLRRIAPNIGPPGTEVEITGSNFGVDISEVSVTISNAGCNVTMVNGSVLRCVA
GDHAGGTFPVLLHHKTKGSGVSTVVFEYPLHIHSIHPEQGSFGGGQILTVTGVGFNPQDS
VISICSTECATDRLRSDRTTLLCEIPPHDGVGPDQVCEVRVVNGKDSSPSTTLFTYMMAL
TPRVTEISPTKGSTAGGTRLTVLGSGFSENPQDVQVTIAEAKCDVEYSNKTHIICVTNAH
TPSGWAPVHVNIRNIGMARQENTYFLYVDIWSSNFSWGGKPPPEEGSLAVITKGQILLLD
QSTPILKMLLIQGGTLIFDEADIELQAENILITDGGTLQVGTETSPFQHQAVITLHGHLR
SPELPVYGAKTLAVREGTLDLHGLPVPVVWTRLAQTAKAGQWTLILQDPVTWKAGDAIVI
ASTGHRHSQQENEKRTIASVSADGVSITLTRPLNYTHLGITVTLPDGSLFEARAEVGILT
RNIIIRGSENVEWNSKIPACPTGFDTGEFATQTCLQGKFGEEIGSDQFGGCVMFHAPLPG
ADVVTGRIEHVEVFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQSYNRAVTIHNTH
HLLVERNIIYDIKGGAFFIEDGIEHGNILQYNLAVFVRQSTSLLNDDVTPAAFWVTNPNN
TIRHNAAAGGTHFGFWYRMNNHPDGPSYDRNICQKRVPLGEFFNNTVHSQGWFGLWIFEE
YFPMETGSCTSTVPLPAVFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNHEAGIETKRIL
APYVGGWGETSGAVIKNAKIVGHLDELGMGTGFCTSKGLVLPFSEGLTVSSVQFMNFDRP
NCVALGVTSITGVCHDKCGGWSAKFVDIQYFHTPNKAGFRWEHEAALIDVDGSLTGHKGH
TVIPHSSLLDPSHCTQEAQWSIGFPGSVCDASVSFHRLAFNKPSPVSLLEKDVVLSDSFG
TSIVPFQKKRLTHTSGWMALIPNANHINWYFRDVDHVTNISYTSTFYGFKEEDYVIISHN
FTQSPDMFSVIDMRNGSSNPLNWNTSKNGDWHLEANTSTLYYLVSGRSDHHQSQSISGTL
DPDVKDVVINFQAYCCTLQDCFPVHPPSRKPIPRRRPASYILWSNHSFWQSSQENNYTVP
HPGAQVVIPEGAWIVADTDLPPMERLIIWGVLELEDKSSVGASGPSYRRIVLNATYISVQ
GGRLIGGWEDNPFKGELQIILRGNHSTPEWALPEGPNQGAKVLGVFGELDLHGLPRLIYK
TKLSETAEAGSKVLSLMDAVDWQEGDEIVITTTSYDLHQTETRSIVRILHGHKILILNDS
LSYNHLAKRYYIPETGQNYILAADVGLLSRNIKIVGEDYPGSSRDSFGARILVGSFTGNM
MTFKGNARISNVEFYHSGQEGFRDSTDPRYAVTFLNLGQIQEHSSSYIRGCAFHHGFSPA
IGVFGTDGVDIDDNVIHFTVGEGIRVWGDANRVRRNLVALSVWPGTYQNRKDSSSTLWHA
AIEINRGTNTVLQNNVVAGFGRVGYRIDGEPCSSQPNPVENWFDNEAHGGLYGVYMNQDG
LPGCSLIQGFTIWMCWDYGIYFQTTERVHIYNVTLVDNGMAIFSMIYMPPAVSHKISSKT
VKVESTLIVGSSPEFNCSDVLRDDDPNIELTGAHRSARPPAGGRSGICWPTFASAHNMAP
WKPHAGIMSYNAISGHLDVSGSTFVGFKNVCSGETNVIFMTNPLNEDLQHPIYVKNIRLV
DTTEPSKIYIHRPDISKVNPSDCVDMVCDAKRKSFLKDLDGSFLGNSGSVIPQAEYEWNG
NSQLGIGDYRIPQVMLTFLNGSRIPVSEKAPYKGIIRDATCKYIPEWQSYQCFGMEYAML
VIESLDSDTETRRLSPVAIVSNGYVDLLNGPQDHGWCVGYTCQRRLSLFHSIVALNKSYE
VYFTGTSPQNLRLMLLNVEHTRAVLVGIFYSTLQRLDVYVNNSLVCPRDTIWNPQQKLCA
FNRDPRADQFLPKLNSTVLGENYFDRTYQMLYILVKGTTPVEIHTAMVIFVSFQLPAVTE
DDFYSSHNLVRNLALFLNIPSHKIRVSKVIREKSLRRKRSTGHSIELEIGEPPMRILSND
TTGQMKLSEFQEISGSLGQAVILGKISGILGFNISSMSITNPIPSPNDSGWIKVTAQPVA
RAAFPVHHVARVSSLSVVTQPVAGQPGQPFSQQPSVKAVDPEGNCVSVGITSLTLKAVLK
DSSNNQVSGLGGNTTILFSSCWANYTDLTPLRTGKNYKLEFLLDDVIRAESRTFSLPVQS
VSGDGGSSTSSSSSGGSNGNHSKASAVGTAAQTVAVLMSCLAGRVLLLEIFMTAAFVLNI
NVGKHINVS
Download sequence
Identical sequences A0A286XHX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]