SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286XLH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286XLH9
Domain Number 1 Region: 13-92
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000492
Family Snake venom toxins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A286XLH9
Sequence length 116
Comment (tr|A0A286XLH9|A0A286XLH9_CAVPO) Ly6/neurotoxin 1 {ECO:0000313|Ensembl:ENSCPOP00000026261} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=LYNX1 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MAALFTLFFVALAGLPLAQALECHVCAYNGDNCFNPMRCPAMVRYCMTTRTYYTPYRMKV
SKSCVPSCFETVYDGYSKHASTTSCCQYDLCNVAGLAVPGALVFAPILLATIWSLI
Download sequence
Identical sequences A0A286XLH9
10141.ENSCPOP00000003562 XP_003473334.1.53824 ENSCPOP00000003562 ENSCPOP00000003562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]