SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286XLN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286XLN5
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.74e-43
Family Calponin-homology domain, CH-domain 0.000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A286XLN5
Sequence length 201
Comment (tr|A0A286XLN5|A0A286XLN5_CAVPO) Transgelin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=TAGLN OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIMQCGSDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEGYGVTKTDMFQTVDLFEG
KDLAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMG
SNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences A0A286XLN5
10141.ENSCPOP00000007817 XP_003472856.1.53824 XP_005378258.1.28644 XP_005378259.1.28644 ENSCPOP00000007817 ENSCPOP00000007817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]