SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286XWV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286XWV4
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily DEATH domain 2.68e-23
Family Caspase recruitment domain, CARD 0.0000104
Further Details:      
 
Domain Number 2 Region: 110-192
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-18
Family DEATH domain, DD 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A286XWV4
Sequence length 199
Comment (tr|A0A286XWV4|A0A286XWV4_CAVPO) CASP2 and RIPK1 domain containing adaptor with death domain {ECO:0000313|Ensembl:ENSCPOP00000030023} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=CRADD OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHVQEIKAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLEKAREEAITELPKGDQVPGIPSHILNSSPSDQQI
NQLAQRLGAEWEHVVLSLGLSQTDVYRCKANHPHNVQSQVVEAFVRWRQRYGKQATFLSL
HKGLQAVEADPSVLQHVLE
Download sequence
Identical sequences A0A286XWV4
XP_013014705.1.53824 ENSCPOP00000015312 10141.ENSCPOP00000015312 ENSCPOP00000015312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]