SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286Y1Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286Y1Q3
Domain Number 1 Region: 53-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.19e-46
Family Regulator of G-protein signaling, RGS 0.00000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A286Y1Q3
Sequence length 181
Comment (tr|A0A286Y1Q3|A0A286Y1Q3_CAVPO) Regulator of G protein signaling 5 {ECO:0000313|Ensembl:ENSCPOP00000031756} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=RGS5 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKIQKPSADEALQ
WRDSLDKVLQNSYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKEIYEEF
IQTEAPKEVNIDHFTKDVTMKNLMEPSLNSFDMAQKRIHALMEKDSLPRFVRSEFYQELV
K
Download sequence
Identical sequences A0A286Y1Q3
ENSCPOP00000010042 10141.ENSCPOP00000010042 XP_003468708.2.53824 ENSCPOP00000010042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]